Weiter angemeldet bleiben?
Abmeldung in: 
Sie wurden abgemeldet
Ihre Sitzung ist abgelaufen. Zu Ihrer Sicherheit haben wir Sie abgemeldet.
Möchten Sie sich wieder anmelden?

Anti-TCHHL1 Rabbit Polyclonal Antibody

Lieferant: Abnova
Rabbit polyclonal antibody raised against recombinant TCHHL1.

Recommended Dilutions: Immunohistochemistry: 1:500-1:1000

Type: Primary
Antigen: TCHHL1
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human



 

BESTELLEN

Erweitert / Kompakt
Größe VE Katalognummer Menge
100 μl 100 µl ABNOPAB23957
Hersteller Artikel Nummer : PAB23957
Barcodes erstellen mehr zu unseren EasyScan, VSR+ und VEM Tools
Barcode Label Format: 
PDF Katalog erstellen

TECHNISCHE DATEN

Antigen symbol TCHHL1
Antigen name Trichohyalin-like 1
Reaktivität Human
Konjugation Unconjugated
Klonalität Polyclonal
Antikörper Typ Primary
Wirt Rabbit
Isotyp IgG
Western blot Yes
ImmunoChemistry Yes
Antigen synonyms basalin, THHL1, TCHHL1 , S100A17, S100 Calcium binding protein A17, intermediate filament-associated protein, trichohyalin-like 1
Gene ID 126637
Format Liquid
Cross adsorption No
Immunogen Recombinant protein corresponding to amino acids of human TCHHL1.
Purification Antigen affinity purification
Sequence KHSNIQEPPLQREDEPSSQHADLPEQAAARSPSQTQKSTDSKDVCRMFDTQEPGKDADQTPAKTKNLGEPEDYGRTSETQEKECETKDLPVQYGSRN
Storage buffer PBS, pH 7,5 (40% glycerol, 0,02% sodium azide)
Lagertemperatur Store at 4 °C. For long term storage store at – 20 °C. Aliquot to avoid repeated freezing and thawing.
Enter Details

Select the article for which you are looking for Certificate

Bitte tragen Sie die Chargennummer ein. Sollte Ihnen diese nicht vorliegen, tragen Sie bitte bei "VWR-Chemikalien" ein "x" ein.

Enter Certificate Details

Enter the Lot number:

Choose from recent batch/lot numbers:

oder
Review & Compare Alternatives
Wir haben eine kostengünstigere Alternative für Sie gefunden. Ihre Einsparung beträgt pro Stück.  To compare product details, select up to 3 alternatives below and click Compare Selected. To add items to your basket, enter a quantity and click Add to Basket.

Ursprünglicher Artikel:

Beschreibung Artikelnummer Availability Einheit Ihr Preis Price Per Menge
 

Neues Design und unsere Verpflichtung unseren Kunden gegenüber

Verlassen Sie sich auf bekannte Funktionen und Ansprechpartner, kombiniert mit Innovation durch Avantor®. Unser neuer Markenauftritt symbolisiert Beweglichkeit und unsere Fähigkeit uns an die Anforderungen unserer Kunden anzupassen.

Learn More Start Shopping