Weiter angemeldet bleiben?
Abmeldung in: 
Sie wurden abgemeldet
Ihre Sitzung ist abgelaufen. Zu Ihrer Sicherheit haben wir Sie abgemeldet.
Möchten Sie sich wieder anmelden?

Anti-C19ORF70 Rabbit Polyclonal Antibody

Lieferant: Abnova
Rabbit polyclonal antibody raised against recombinant C19orf70.

Recommended Dilutions: Immunohistochemistry: 1:10-1:20

Type: Primary
Antigen: C19ORF70
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human




 

BESTELLEN

Erweitert / Kompakt
Größe VE Katalognummer Menge
100 μl 100 µl ABNOPAB23966
Hersteller Artikel Nummer : PAB23966
Barcodes erstellen mehr zu unseren EasyScan, VSR+ und VEM Tools
Barcode Label Format: 
PDF Katalog erstellen

TECHNISCHE DATEN

Antigen symbol C19orf70
Antigen name Chromosome 19 open reading frame 70
Reaktivität Human
Konjugation Unconjugated
Klonalität Polyclonal
Antikörper Typ Primary
Wirt Rabbit
Isotyp IgG
ImmunoChemistry Yes
Antigen synonyms P117, QIL1, MIC13
Gene ID 125988
Format Liquid
Cross adsorption No
Immunogen Recombinant protein corresponding to amino acids of human C19orf70.
Purification Antigen affinity purification
Sequence VYLVYDQELLGPSDKSQAALQKAGEVVPPAMYQFSQYVCQQTGLQIPQLPAPPKIYFPIRDSWNAGIMTVMSALSVAPSKAREYSKEGWEYVK
Storage buffer PBS, pH 7,5 (40% glycerol, 0,02% sodium azide)
Lagertemperatur Store at 4 °C. For long term storage store at – 20 °C. Aliquot to avoid repeated freezing and thawing.
Enter Details

Select the article for which you are looking for Certificate

Bitte tragen Sie die Chargennummer ein. Sollte Ihnen diese nicht vorliegen, tragen Sie bitte bei "VWR-Chemikalien" ein "x" ein.

Enter Certificate Details

Enter the Lot number:

Choose from recent batch/lot numbers:

oder
Review & Compare Alternatives
Wir haben eine kostengünstigere Alternative für Sie gefunden. Ihre Einsparung beträgt pro Stück.  To compare product details, select up to 3 alternatives below and click Compare Selected. To add items to your basket, enter a quantity and click Add to Basket.

Ursprünglicher Artikel:

Beschreibung Artikelnummer Availability Einheit Ihr Preis Price Per Menge
 

Neues Design und erhöhtes Engagement

Bauen Sie auf bekannte Funtkionen und Ressourcen von Avantor – optimiert mit Innovation®. Unsere neue Marke steht für Gewandtheit und die Fähigkeit, sich unseren Kundenbedürfnissen anzupassen.

MEHR ERFAHREN EINKAUF BEGINNEN