Weiter angemeldet bleiben?
Abmeldung in: 
Sie wurden abgemeldet
Ihre Sitzung ist abgelaufen. Zu Ihrer Sicherheit haben wir Sie abgemeldet.
Möchten Sie sich wieder anmelden?

Anti-ADGRA1 Rabbit Polyclonal Antibody

Lieferant: Abnova
Rabbit polyclonal antibody raised against recombinant GPR123.

Recommended Dilutions: Immunohistochemistry: 1:50-1:200; Immunofluorescence: 1-4 μg/ml

Type: Primary
Antigen: ADGRA1
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human



Melden Sie sich an um Ihre Preise und die Verfügbarkeiten zu sehen
  Auf diesem Gerät angemeldet bleiben
 

BESTELLEN

Erweitert / Kompakt
Größe VE Katalognummer Menge
100 μl 100 µl ABNOPAB23978
Hersteller Artikel Nummer : PAB23978
Barcodes erstellen mehr zu unseren EasyScan, VSR+ und VEM Tools
Barcode Label Format: 
PDF Katalog erstellen

TECHNISCHE DATEN

Antigen symbol ADGRA1
Antigen name Adhesion G Protein-Coupled Receptor A1
Reaktivität Human
Konjugation Unconjugated
Klonalität Polyclonal
Antikörper Typ Primary
Wirt Rabbit
Isotyp IgG
ImmunoChemistry Yes
ImmunoFluorescence Yes
Antigen synonyms GPR123
Gene ID 84435
Format Liquid
Cross adsorption No
Immunogen Recombinant protein corresponding to amino acids of human GPR123.
Purification Antigen affinity purification
Sequence PCKMTNLQAAQGHASCLSPATPCCAKMHCEPLTADEAHVHLQEEGAFGHDPHLHGCLQGRTKPPYFSRHPAEEPEYAYHIPSSLDGSPRSSRTDSPPSSLDG
Storage buffer PBS, pH 7,5 (40% glycerol, 0,02% sodium azide)
Lagertemperatur Store at 4 °C. For long term storage store at – 20 °C. Aliquot to avoid repeated freezing and thawing.
Enter Details

Select the article for which you are looking for Certificate

Bitte tragen Sie die Chargennummer ein. Sollte Ihnen diese nicht vorliegen, tragen Sie bitte bei "VWR-Chemikalien" ein "x" ein.

Enter Certificate Details

Enter the Lot number:

Choose from recent batch/lot numbers:

oder
Review & Compare Alternatives
Wir haben eine kostengünstigere Alternative für Sie gefunden. Ihre Einsparung beträgt pro Stück.  To compare product details, select up to 3 alternatives below and click Compare Selected. To add items to your basket, enter a quantity and click Add to Basket.

Ursprünglicher Artikel:

Beschreibung Artikelnummer Availability Einheit Ihr Preis Price Per Menge