Weiter angemeldet bleiben?
Abmeldung in: 
Sie wurden abgemeldet
Ihre Sitzung ist abgelaufen. Zu Ihrer Sicherheit haben wir Sie abgemeldet.
Möchten Sie sich wieder anmelden?

Anti-SPG21 Mouse Monoclonal Antibody [clone: 2B11]

Lieferant: US Biological
Type: Primary
Antigen: SPG21 (spastic paraplegia 21 (autosomal recessive, Mast syndrome))
Clonality: monoclonal
Clone: 2B11
Conjugation: unconjugated
Epitope:
Host: Mouse
Isotype: IgG2a Kappa
Reactivity: Human




 

BESTELLEN

Erweitert / Kompakt
Größe VE Katalognummer Menge
100 µg 100 µG USBI133761
Hersteller Artikel Nummer : 133761
Barcodes erstellen mehr zu unseren EasyScan, VSR+ und VEM Tools
Barcode Label Format: 
PDF Katalog erstellen

TECHNISCHE DATEN

Antigen symbol SPG21
Antigen name spastic paraplegia 21 (autosomal recessive, Mast syndrome)
Reaktivität Human
Konjugation Unconjugated
Klonalität Monoclonal
Antikörper Typ Primary
Clone 2B11
Host Mouse
Isotype IgG2a kappa
ELISA Yes
Amino acid number 211 to 307
Purification purified by Protein A chromatography
Sequence PHKIRDIPVTIMDVFDQSALSTEAKEEMYKLYPNARRAHLKTGGNFPYLCRSAEVNLYVQIHLLQFHGTKYAAIDPSMVSAEELEVQKGSLGISQE
Form liquid
Storage buffer PBS, pH 7,2.
Lagertemperatur Cool
Transporttemperatur Ice
Enter Details

Select the article for which you are looking for Certificate

Bitte tragen Sie die Chargennummer ein. Sollte Ihnen diese nicht vorliegen, tragen Sie bitte bei "VWR-Chemikalien" ein "x" ein.

Enter Certificate Details

Enter the Lot number:

Choose from recent batch/lot numbers:

oder
Review & Compare Alternatives
Wir haben eine kostengünstigere Alternative für Sie gefunden. Ihre Einsparung beträgt pro Stück.  To compare product details, select up to 3 alternatives below and click Compare Selected. To add items to your basket, enter a quantity and click Add to Basket.

Ursprünglicher Artikel:

Beschreibung Artikelnummer Availability Einheit Ihr Preis Price Per Menge