Weiter angemeldet bleiben?
Abmeldung in: 
Sie wurden abgemeldet
Ihre Sitzung ist abgelaufen. Zu Ihrer Sicherheit haben wir Sie abgemeldet.
Möchten Sie sich wieder anmelden?

Anti-SP1 Mouse Monoclonal Antibody [clone: 1A5]

Lieferant: US Biological
Recommended dilution: Immunofluorescence: 10 μg/ml; Immunochemistry: 1 μg/ml

Type: Primary
Antigen: SP1 (Sp1 transcription factor)
Clonality: monoclonal
Clone: 1A5
Conjugation: unconjugated
Epitope:
Host: Mouse
Isotype: IgG1
Reactivity: Human, Mouse




 

BESTELLEN

Erweitert / Kompakt
Größe VE Katalognummer Menge
100 µg 100 µG USBI133731
Hersteller Artikel Nummer : 133731
Barcodes erstellen mehr zu unseren EasyScan, VSR+ und VEM Tools
Barcode Label Format: 
PDF Katalog erstellen

TECHNISCHE DATEN

Antigen symbol SP1
Antigen name Sp1 transcription factor
Reaktivität Mouse, Human
Konjugation Unconjugated
Klonalität Monoclonal
Antikörper Typ Primary
Clone 1A5
Host Mouse
Isotype IgG1
Western blot Yes
ELISA Yes
ImmunoFluorescence Yes
Amino acid number 89 to 199
Purification purified by Protein A chromatography
Sequence GTGELDLTATQLSQGANGWQIISSSSGATPTSKEQSGSSTNGSNGSESSKNRTVSGGQYVVAAAPNLQNQQVLTGLPGVMPNIQYQVIPQFQTVDGQQLQFAATGAQVQQ*
Form liquid
Storage buffer PBS, pH 7,2.
Lagertemperatur Cool
Transporttemperatur Ice
Enter Details

Select the article for which you are looking for Certificate

Bitte tragen Sie die Chargennummer ein. Sollte Ihnen diese nicht vorliegen, tragen Sie bitte bei "VWR-Chemikalien" ein "x" ein.

Enter Certificate Details

Enter the Lot number:

Choose from recent batch/lot numbers:

oder
Review & Compare Alternatives
Wir haben eine kostengünstigere Alternative für Sie gefunden. Ihre Einsparung beträgt pro Stück.  To compare product details, select up to 3 alternatives below and click Compare Selected. To add items to your basket, enter a quantity and click Add to Basket.

Ursprünglicher Artikel:

Beschreibung Artikelnummer Availability Einheit Ihr Preis Price Per Menge