Weiter angemeldet bleiben?
Abmeldung in: 
Sie wurden abgemeldet
Ihre Sitzung ist abgelaufen. Zu Ihrer Sicherheit haben wir Sie abgemeldet.
Möchten Sie sich wieder anmelden?

Anti-SORCS2 Mouse Monoclonal Antibody [clone: 1D7]

Lieferant: US Biological
Recommended dilution: ELISA: 0.1ng/ml

Type: Primary
Antigen: SORCS2 (sortilin-related VPS10 domain containing receptor 2)
Clonality: monoclonal
Clone: 1D7
Conjugation: unconjugated
Epitope:
Host: Mouse
Isotype: IgG2a Kappa
Reactivity: Human




 

BESTELLEN

Erweitert / Kompakt
Größe VE Katalognummer Menge
100 µg 100 µG USBI133704
Hersteller Artikel Nummer : 133704
Barcodes erstellen mehr zu unseren EasyScan, VSR+ und VEM Tools
Barcode Label Format: 
PDF Katalog erstellen

TECHNISCHE DATEN

Antigen symbol SORCS2
Antigen name sortilin-related VPS10 domain containing receptor 2
Reaktivität Human
Konjugation Unconjugated
Klonalität Monoclonal
Antikörper Typ Primary
Clone 1D7
Wirt Mouse
Isotyp IgG2a kappa
Western blot Yes
ELISA Yes
Amino acid number 802 to 901
Purification purified by Protein A chromatography
Sequence VLRVLDQFQVMPLQFSKELDAYNPNTPEWREDVGLVVTRLLSKETSVPQELLVTVVKPGLPTLADLYVLLPPPRPTRKRSLSSDKRLAAIQQVLNAQKI
Form liquid
Storage buffer PBS, pH 7,2.
Lagertemperatur Cool
Transporttemperatur Ice
Enter Details

Select the article for which you are looking for Certificate

Bitte tragen Sie die Chargennummer ein. Sollte Ihnen diese nicht vorliegen, tragen Sie bitte bei "VWR-Chemikalien" ein "x" ein.

Enter Certificate Details

Enter the Lot number:

Choose from recent batch/lot numbers:

oder
Review & Compare Alternatives
Wir haben eine kostengünstigere Alternative für Sie gefunden. Ihre Einsparung beträgt pro Stück.  To compare product details, select up to 3 alternatives below and click Compare Selected. To add items to your basket, enter a quantity and click Add to Basket.

Ursprünglicher Artikel:

Beschreibung Artikelnummer Availability Einheit Ihr Preis Price Per Menge