Weiter angemeldet bleiben?
Abmeldung in: 
Sie wurden abgemeldet
Ihre Sitzung ist abgelaufen. Zu Ihrer Sicherheit haben wir Sie abgemeldet.
Möchten Sie sich wieder anmelden?

Anti-SOD3 Mouse Monoclonal Antibody [clone: 5C3]

Lieferant: US Biological
Type: Primary
Antigen: SOD3 (superoxide dismutase 3, extracellular)
Clonality: monoclonal
Clone: 5C3
Conjugation: unconjugated
Epitope:
Host: Mouse
Isotype: IgG
Reactivity: Human




 

BESTELLEN

Erweitert / Kompakt
Größe VE Katalognummer Menge
100 µg 100 µG USBI133697
Hersteller Artikel Nummer : 133697
Barcodes erstellen mehr zu unseren EasyScan, VSR+ und VEM Tools
Barcode Label Format: 
PDF Katalog erstellen

TECHNISCHE DATEN

Antigen symbol SOD3
Antigen name Superoxide Dismutase 3
Reaktivität Human
Konjugation Unconjugated
Klonalität Monoclonal
Antikörper Typ Primary
Clone 5C3
Wirt Mouse
Isotyp IgG
Western blot Yes
ELISA Yes
Purification purified by Protein A chromatography
Sequence EPNSDSAEWIRDMYAKVTEIWQEVMQRRDDDGTLHAACQVQPSATLDAAQPRVTGVVLFRQLAPRAKLDAFFALEGFPTEPNSSSRAIHVHQFGDLSQGC
Form liquid
Storage buffer PBS, pH 7,2.
Lagertemperatur Cool
Transporttemperatur Ice
Enter Details

Select the article for which you are looking for Certificate

Bitte tragen Sie die Chargennummer ein. Sollte Ihnen diese nicht vorliegen, tragen Sie bitte bei "VWR-Chemikalien" ein "x" ein.

Enter Certificate Details

Enter the Lot number:

Choose from recent batch/lot numbers:

oder
Review & Compare Alternatives
Wir haben eine kostengünstigere Alternative für Sie gefunden. Ihre Einsparung beträgt pro Stück.  To compare product details, select up to 3 alternatives below and click Compare Selected. To add items to your basket, enter a quantity and click Add to Basket.

Ursprünglicher Artikel:

Beschreibung Artikelnummer Availability Einheit Ihr Preis Price Per Menge
 

Neues Design und unsere Verpflichtung unseren Kunden gegenüber

Verlassen Sie sich auf bekannte Funktionen und Ansprechpartner, kombiniert mit Innovation durch Avantor®. Unser neuer Markenauftritt symbolisiert Beweglichkeit und unsere Fähigkeit uns an die Anforderungen unserer Kunden anzupassen.

Learn More Start Shopping